PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0404s0280.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 536aa    MW: 60547.9 Da    PI: 4.6824
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0404s0280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS358.97.2e-1101575281374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalk 82 
                             l +lLl+cAea+  +d++la+++L ++   +sp gd++qR+  +f+ +L+ rl++  +++ +  + ++   ++      +e++ a++
  SapurV1A.0404s0280.1.p 157 LLHLLLACAEALGCRDTRLAETMLGQIWPSVSPWGDSLQRVSYCFAMGLKCRLSH-LNNVNANGTFTNGGAMDrsliiREEKMEAFH 242
                             579***************************************************9.555554444444444445578889999999* PP

                    GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169
                             l+++ +P++ f++++aN+aI +a+++++++HiiD+++++ lQWp+L++aLasRpegpp+lRiTg+ +  +++  ele+  + La+ A
  SapurV1A.0404s0280.1.p 243 LLHQKTPYIAFGFMAANEAICQAAQEKDTLHIIDLGMEHALQWPSLMRALASRPEGPPKLRITGLTD--EHNLSELETSMKELAEEA 327
                             *******************************************************************..55999************* PP

                    GRAS 170 eelgvpfefnvlvak..rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                             ++lg+++efn++ ++  +   l+ e+L++++gEal  n++++lhr+++es  + +   ++L+++k+l+P +++vveq+a+hn++ Fl
  SapurV1A.0404s0280.1.p 328 SSLGIRLEFNMI-SDpvTPLLLTAENLKLREGEALFFNSIMHLHRFVKESRGSLK---AILQAIKRLNPALLTVVEQDANHNGPFFL 410
                             ***********5.6623555679************************88777666...9**************************** PP

                    GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                              rf+e+l+yysa++dslea+lpr+s +r+k+E++ + +ei+n++a eg +r+erhe++ +Wr++l++aGF+ + l+   ++qa+ +l
  SapurV1A.0404s0280.1.p 411 GRFIESLHYYSAILDSLEASLPRNSPQRMKIEKVKFCKEICNIIAYEGCNRTERHERVDRWRRQLSRAGFQVMGLK--CMSQARVML 495
                             ************************************************************************9985..89******* PP

                    GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             + ++ dgy++  e+g+l+lgWk+rp++ +SaW+
  SapurV1A.0404s0280.1.p 496 SVYGIDGYTLATEKGCLLLGWKGRPIMLASAWQ 528
                             ********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.144131510IPR005202Transcription factor GRAS
PfamPF035142.5E-107157528IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MDGMDDWLSF SMQESLDHDL AIRRFCPARM ELEQGEESWE EITFSEIELL SPDDDSTGPP  60
HLAASEVDEL VDSFINVDQD GDKDNKSHEK DQEFKQFQDD NIEGFSMLDD VFPDVPMMSI  120
EGDELEMRSS FEDPEAVPYT EPVQEKITQG VDQGLHLLHL LLACAEALGC RDTRLAETML  180
GQIWPSVSPW GDSLQRVSYC FAMGLKCRLS HLNNVNANGT FTNGGAMDRS LIIREEKMEA  240
FHLLHQKTPY IAFGFMAANE AICQAAQEKD TLHIIDLGME HALQWPSLMR ALASRPEGPP  300
KLRITGLTDE HNLSELETSM KELAEEASSL GIRLEFNMIS DPVTPLLLTA ENLKLREGEA  360
LFFNSIMHLH RFVKESRGSL KAILQAIKRL NPALLTVVEQ DANHNGPFFL GRFIESLHYY  420
SAILDSLEAS LPRNSPQRMK IEKVKFCKEI CNIIAYEGCN RTERHERVDR WRRQLSRAGF  480
QVMGLKCMSQ ARVMLSVYGI DGYTLATEKG CLLLGWKGRP IMLASAWQVH NLFSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-451575284375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1469476RWRRQLSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2167700.0AC216770.1 Populus trichocarpa clone POP051-A24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306397.10.0hypothetical protein POPTR_0005s09790g
TrEMBLB9H6090.0B9H609_POPTR; Uncharacterized protein
STRINGPOPTR_0005s09790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132512730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-72RGA-like 1